P2RX7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2133339
Article Name: P2RX7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2133339
Supplier Catalog Number: orb2133339
Alternative Catalog Number: BYT-ORB2133339-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human P2RX7
Conjugation: HRP
Alternative Names: P2X7
P2RX7 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 69kDa
NCBI: 803176
UniProt: Q99572
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP