DUSP12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2138533
Article Name: DUSP12 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138533
Supplier Catalog Number: orb2138533
Alternative Catalog Number: BYT-ORB2138533-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DUSP12
Conjugation: HRP
Alternative Names: YVH1, DUSP1
DUSP12 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 009171
UniProt: Q9UNI6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSR