DUSP12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2138535
Article Name: DUSP12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138535
Supplier Catalog Number: orb2138535
Alternative Catalog Number: BYT-ORB2138535-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DUSP12
Conjugation: FITC
Alternative Names: YVH1, DUSP1
DUSP12 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 009171
UniProt: Q9UNI6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSR