Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)

Catalog Number: BYT-ORB2280235
Article Name: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial (Active)
Biozol Catalog Number: BYT-ORB2280235
Supplier Catalog Number: orb2280235
Alternative Catalog Number: BYT-ORB2280235-1,BYT-ORB2280235-100,BYT-ORB2280235-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Low affinity immunoglobulin gamma Fc region receptor II-a, IgG Fc receptor II-a, CDw32, Fc-gamma RII-a (Fc-gamma-RIIa, FcRII-a), CD32, FCGR2A, CD32, FCG2, FCGR2A1, IGFR2
This Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-a (FCGR2A), partial spans the amino acid sequence from region 34-217aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 23.2 kDa
UniProt: P12318
Buffer: Liquid or Lyophilized powder
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC.
Form: Lyophilized powder
Sequence: QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMG
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FCGR2A at 2 µg/mL can bind Anti-FCGR2A recombinant antibody. The EC50 is 24.44-32.57 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of FCGR2A was greater than 90% as determined by SEC-HPLC