Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial

Catalog Number: BYT-ORB2280236
Article Name: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial
Biozol Catalog Number: BYT-ORB2280236
Supplier Catalog Number: orb2280236
Alternative Catalog Number: BYT-ORB2280236-1,BYT-ORB2280236-100,BYT-ORB2280236-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Fc-gamma RIII-beta,CD16-I,Fc-gamma RIII,Fc-gamma RIIIb,FcRIII,FcRIIIb,FcR-10,IgG Fc receptor III-1,CD antigen CD16b
This Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial spans the amino acid sequence from region 17-200aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 20.8 kDa
UniProt: O75015
Buffer: Liquid or Lyophilized powder
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of FCGR3B was greater than 95% as determined by SEC-HPLC