Human HMGCR protein

Catalog Number: BYT-ORB244273
Article Name: Human HMGCR protein
Biozol Catalog Number: BYT-ORB244273
Supplier Catalog Number: orb244273
Alternative Catalog Number: BYT-ORB244273-20,BYT-ORB244273-100,BYT-ORB244273-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HMGCR
This Human HMGCR protein spans the amino acid sequence from region 588-887aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 36 kDa
UniProt: P04035
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of the full length of 1-888aa of His-tag and expression region is 588-887aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.