Human HSD11B1 protein

Catalog Number: BYT-ORB244279
Article Name: Human HSD11B1 protein
Biozol Catalog Number: BYT-ORB244279
Supplier Catalog Number: orb244279
Alternative Catalog Number: BYT-ORB244279-20,BYT-ORB244279-100,BYT-ORB244279-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: HSD11B1
This Human HSD11B1 protein spans the amino acid sequence from region 25-292aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.5 kDa
UniProt: P28845
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 25-292aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.