Human ID1 protein

Catalog Number: BYT-ORB244283
Article Name: Human ID1 protein
Biozol Catalog Number: BYT-ORB244283
Supplier Catalog Number: orb244283
Alternative Catalog Number: BYT-ORB244283-20,BYT-ORB244283-100,BYT-ORB244283-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: ID1
This Human ID1 protein spans the amino acid sequence from region 1-155aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32.1 kDa
UniProt: P41134
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-155aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.