Human IDH3B protein

Catalog Number: BYT-ORB244286
Article Name: Human IDH3B protein
Biozol Catalog Number: BYT-ORB244286
Supplier Catalog Number: orb244286
Alternative Catalog Number: BYT-ORB244286-20,BYT-ORB244286-100,BYT-ORB244286-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IDH3B
This Human IDH3B protein spans the amino acid sequence from region 35-385aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 65.8 kDa
UniProt: O43837
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRAKSQRIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAG
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of GST-tag and expression region is 35-385aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.