Sheep IFNG protein

Catalog Number: BYT-ORB244296
Article Name: Sheep IFNG protein
Biozol Catalog Number: BYT-ORB244296
Supplier Catalog Number: orb244296
Alternative Catalog Number: BYT-ORB244296-20,BYT-ORB244296-100,BYT-ORB244296-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IFNG
This Sheep IFNG protein spans the amino acid sequence from region 24-166a. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 20.9 kDa
UniProt: P17773
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Ovis aries (Sheep)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QGPFFKEIENLKEYFNASNPDVAKGGPLFSEILKNWKEESDKKIIQSQIVSFYFKLFENLKDNQVIQRSMDIIKQDMFQKFLNGSSEKLEDFKRLIQIPVDDLQIQRKAINELIKVMNDLSPKSNLRKRKRSQNLFRGRRASM
Application Notes: Biological Origin: Ovis aries (Sheep). Application Notes: Full length of His-tag and expression region is 24-166a
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.