Dog L4 protein

Catalog Number: BYT-ORB244305
Article Name: Dog L4 protein
Biozol Catalog Number: BYT-ORB244305
Supplier Catalog Number: orb244305
Alternative Catalog Number: BYT-ORB244305-20,BYT-ORB244305-100,BYT-ORB244305-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: L4
This Dog L4 protein spans the amino acid sequence from region 25-132aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 16.8 kDa
UniProt: O77762
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Canis lupus familiaris (Dog) (Canis familiaris)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH
Application Notes: Biological Origin: Canis lupus familiaris (Dog) (Canis familiaris). Application Notes: Full length of His-tag and expression region is 25-132aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.