Rat Itgb1 protein

Catalog Number: BYT-ORB244312
Article Name: Rat Itgb1 protein
Biozol Catalog Number: BYT-ORB244312
Supplier Catalog Number: orb244312
Alternative Catalog Number: BYT-ORB244312-20,BYT-ORB244312-100,BYT-ORB244312-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Itgb1
This Rat Itgb1 protein spans the amino acid sequence from region 21-729aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 94.4 kDa
UniProt: P49134
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPTSARCDDLEALKKKGCHPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLLLKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLV
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Extracellular domain of His-SUMO-tag and expression region is 21-729aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.