Human VEGFR2 protein

Catalog Number: BYT-ORB244321
Article Name: Human VEGFR2 protein
Biozol Catalog Number: BYT-ORB244321
Supplier Catalog Number: orb244321
Alternative Catalog Number: BYT-ORB244321-20,BYT-ORB244321-100,BYT-ORB244321-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: CD309 protein, CD309 antigen protein, Fetal liver kinase 1 protein, FLK-1 protein, FLK1 protein, FLK1, mouse, homolog of protein, KDR protein, Kinase insert domain receptor (a type III receptor tyrosine kinase) protein, Kinase insert domain receptor protein, KRD1 protein, Ly73 protein, Protein tyrosine kinase receptor FLK1 protein, Protein-tyrosine kinase receptor flk-1 protein, soluble VEGFR2 protein, Tyrosine kinase growth factor receptor protein, Vascular endothelial growth factor receptor 2 protein, VEGFR 2 protein, VEGFR protein, VEGFR-2 protein, VEGFR2 protein
This Human VEGFR2 protein spans the amino acid sequence from region 20-764aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 110.3 kDa
UniProt: P35968
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Extracellular domain of GST-tag and expression region is 20-764aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.