Mouse Kif1a protein

Catalog Number: BYT-ORB244322
Article Name: Mouse Kif1a protein
Biozol Catalog Number: BYT-ORB244322
Supplier Catalog Number: orb244322
Alternative Catalog Number: BYT-ORB244322-20,BYT-ORB244322-100,BYT-ORB244322-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Kif1a
This Mouse Kif1a protein spans the amino acid sequence from region 1-361aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 56.4 kDa
UniProt: P33173
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERA
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Partial of the full length of 1-361aa Kinesin-motor domain of His-SUMO-tag and expression region is 1-361aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.