Human KLK7 protein

Catalog Number: BYT-ORB244325
Article Name: Human KLK7 protein
Biozol Catalog Number: BYT-ORB244325
Supplier Catalog Number: orb244325
Alternative Catalog Number: BYT-ORB244325-20,BYT-ORB244325-100,BYT-ORB244325-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: KLK7, PRSS6, SCCE
This Human KLK7 protein spans the amino acid sequence from region 28-253aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.7 kDa
UniProt: P49862
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-tag9.4 and expression region is 28-253aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.