Rat Klkb1 protein

Catalog Number: BYT-ORB244326
Article Name: Rat Klkb1 protein
Biozol Catalog Number: BYT-ORB244326
Supplier Catalog Number: orb244326
Alternative Catalog Number: BYT-ORB244326-20,BYT-ORB244326-100,BYT-ORB244326-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Klkb1
This Rat Klkb1 protein spans the amino acid sequence from region 391-638aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 31.8 kDa
UniProt: P14272
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Plasma kallikrein light chain of His-tag and expression region is 391-638aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.