Human KRT4 protein

Catalog Number: BYT-ORB244333
Article Name: Human KRT4 protein
Biozol Catalog Number: BYT-ORB244333
Supplier Catalog Number: orb244333
Alternative Catalog Number: BYT-ORB244333-20,BYT-ORB244333-100,BYT-ORB244333-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: KRT4
This Human KRT4 protein spans the amino acid sequence from region 1-534aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 73.3 kDa
UniProt: P19013
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGAGGFGAGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-534aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.