Human LILRA5 protein

Catalog Number: BYT-ORB244347
Article Name: Human LILRA5 protein
Biozol Catalog Number: BYT-ORB244347
Supplier Catalog Number: orb244347
Alternative Catalog Number: BYT-ORB244347-20,BYT-ORB244347-100,BYT-ORB244347-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: LILRA5
This Human LILRA5 protein spans the amino acid sequence from region 42-268aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.2 kDa
UniProt: A6NI73
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Extracellular domain of His-tag and expression region is 42-268aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.