Human LRBA protein

Catalog Number: BYT-ORB244353
Article Name: Human LRBA protein
Biozol Catalog Number: BYT-ORB244353
Supplier Catalog Number: orb244353
Alternative Catalog Number: BYT-ORB244353-20,BYT-ORB244353-100,BYT-ORB244353-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: LRBA BGL CDC4L LBA
This Human LRBA protein spans the amino acid sequence from region 1267-1500aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 29.8 kDa
UniProt: P50851
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: PQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPV
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of the full length of 2-2863aa of His-tag and expression region is 1267-1500aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.