Mouse Lypla1 protein

Catalog Number: BYT-ORB244358
Article Name: Mouse Lypla1 protein
Biozol Catalog Number: BYT-ORB244358
Supplier Catalog Number: orb244358
Alternative Catalog Number: BYT-ORB244358-20,BYT-ORB244358-100,BYT-ORB244358-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Lypla1 Apt1 Pla1a
This Mouse Lypla1 protein spans the amino acid sequence from region 1-230aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.7 kDa
UniProt: P97823
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Full length of GST-tag and expression region is 1-230aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.