E.coli MAPT protein

Catalog Number: BYT-ORB244365
Article Name: E.coli MAPT protein
Biozol Catalog Number: BYT-ORB244365
Supplier Catalog Number: orb244365
Alternative Catalog Number: BYT-ORB244365-20,BYT-ORB244365-100,BYT-ORB244365-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MAPT
This E.coli MAPT protein spans the amino acid sequence from region 2-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 63.8 kDa
UniProt: P57786
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Macaca mulatta (Rhesus macaque)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEPRQEFDVMEDHAGTYGLGDRKDQEGYTMLQDQEGDTDAGLKESPLQTPAEDGSEELGSETSDAKSTPTAEDVTAPLVDERAPGEQAAAQPHMEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSATKQVQRKPPPAEPTSERGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPAREPKKVAVVRTPPKSPSS
Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque). Application Notes: Full length of His-SUMO-tag and expression region is 2-459aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.