Rat Mmp2 protein

Catalog Number: BYT-ORB244378
Article Name: Rat Mmp2 protein
Biozol Catalog Number: BYT-ORB244378
Supplier Catalog Number: orb244378
Alternative Catalog Number: BYT-ORB244378-20,BYT-ORB244378-100,BYT-ORB244378-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Mmp2
This Rat Mmp2 protein spans the amino acid sequence from region 110-662aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 78.1 kDa
UniProt: P33436
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rattus norvegicus (Rat)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCT
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: Full length of 72 kDa type IV collagenase chain of His-SUMO-tag and expression region is 110-662aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.