E. coli manA protein

Catalog Number: BYT-ORB244380
Article Name: E. coli manA protein
Biozol Catalog Number: BYT-ORB244380
Supplier Catalog Number: orb244380
Alternative Catalog Number: BYT-ORB244380-20,BYT-ORB244380-100,BYT-ORB244380-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: manA
This E. coli manA protein spans the amino acid sequence from region 1-391aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 58.8 kDa
UniProt: P00946
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Escherichia coli (strain K12)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAELWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLLGEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNSEIGFAKENAAGIPMDAAERNYKDPNHKPELVFALTPFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQPDAERLSELFASLLNMQGEEKSRALAILKSALDSQQGEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGEAMFLFAETPH
Application Notes: Biological Origin: Escherichia coli (strain K12). Application Notes: Full length of His-SUMO-tag and expression region is 1-391aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.