Mouse Msln protein

Catalog Number: BYT-ORB244390
Article Name: Mouse Msln protein
Biozol Catalog Number: BYT-ORB244390
Supplier Catalog Number: orb244390
Alternative Catalog Number: BYT-ORB244390-20,BYT-ORB244390-100,BYT-ORB244390-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Msln
This Mouse Msln protein spans the amino acid sequence from region 298-600aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 50.1 kDa
UniProt: Q61468
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDL
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: Mesothelin, cleaved form of His-SUMO-tag and expression region is 298-600aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.