Human MUSK protein

Catalog Number: BYT-ORB244391
Article Name: Human MUSK protein
Biozol Catalog Number: BYT-ORB244391
Supplier Catalog Number: orb244391
Alternative Catalog Number: BYT-ORB244391-20,BYT-ORB244391-100,BYT-ORB244391-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MUSK
This Human MUSK protein spans the amino acid sequence from region 24-495aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 78.8 kDa
UniProt: O15146
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: LPKAPVITTPLETVDALVEEVATFMCAVESYPQPEISWTRNKILIKLFDTRYSIRENGQLLTILSVEDSDDGIYCCTANNGVGGAVESCGALQVKMKPKITRPPINVKIIEGLKAVLPCTTMGNPKPSVSWIKGDSPLRENSRIAVLESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKVVKLEVEEESEPEQDTKVFARILRAPESHNVTFGSFVTLHCTATGIPVPTITWIENGNAVSSGSIQESVKDRVIDS
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Extracellular domain of GST-tag and expression region is 24-495aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.