Human MYEF2 protein

Catalog Number: BYT-ORB244394
Article Name: Human MYEF2 protein
Biozol Catalog Number: BYT-ORB244394
Supplier Catalog Number: orb244394
Alternative Catalog Number: BYT-ORB244394-20,BYT-ORB244394-100,BYT-ORB244394-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MYEF2
This Human MYEF2 protein spans the amino acid sequence from region 372-576aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37.3 kDa
UniProt: Q9P2K5
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of His-SUMO-tag and expression region is 372-576aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.