Human NGB protein

Catalog Number: BYT-ORB244403
Article Name: Human NGB protein
Biozol Catalog Number: BYT-ORB244403
Supplier Catalog Number: orb244403
Alternative Catalog Number: BYT-ORB244403-20,BYT-ORB244403-100,BYT-ORB244403-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: NGB
This Human NGB protein spans the amino acid sequence from region 1-151aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 32.9 kDa
UniProt: Q9NPG2
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Full length of His-SUMO-tag and expression region is 1-151aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.