Human OGT protein

Catalog Number: BYT-ORB244420
Article Name: Human OGT protein
Biozol Catalog Number: BYT-ORB244420
Supplier Catalog Number: orb244420
Alternative Catalog Number: BYT-ORB244420-20,BYT-ORB244420-100,BYT-ORB244420-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: OGT
This Human OGT protein spans the amino acid sequence from region 606-1022aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 62.5 kDa
UniProt: O15294
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MAEANHFIDLSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANMFPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCPDGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNGLATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDPSTLQM
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial of His-SUMO-tag and expression region is 606-1022aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.