Yeast lolA protein
Catalog Number:
BYT-ORB246132
- Images (3)
| Article Name: | Yeast lolA protein |
| Biozol Catalog Number: | BYT-ORB246132 |
| Supplier Catalog Number: | orb246132 |
| Alternative Catalog Number: | BYT-ORB246132-20,BYT-ORB246132-100,BYT-ORB246132-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | lolA |
| This Yeast lolA protein spans the amino acid sequence from region 22-203aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 22.3 kDa |
| UniProt: | A7ZYJ5 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Escherichia coli O9:H4 (strain HS) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK |
| Application Notes: | Biological Origin: Escherichia coli O9:H4 (strain HS). Application Notes: This is His-tag protein |



