Sheep TGFA protein
Catalog Number:
BYT-ORB246450
- Images (3)
| Article Name: | Sheep TGFA protein |
| Biozol Catalog Number: | BYT-ORB246450 |
| Supplier Catalog Number: | orb246450 |
| Alternative Catalog Number: | BYT-ORB246450-20,BYT-ORB246450-100,BYT-ORB246450-1 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | TGFA |
| This Sheep TGFA protein spans the amino acid sequence from region 24-97aa. Purity: Greater than 90% as determined by SDS-PAGE. |
| Molecular Weight: | 34.9 kDa |
| UniProt: | P98135 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Ovis aries (Sheep) |
| Purity: | Greater than 90% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ |
| Application Notes: | Biological Origin: Ovis aries (Sheep). Application Notes: Full length of Extracellular of GST-tag and expression region is 24-97aa |



