E.coli LMP1 protein

Catalog Number: BYT-ORB246485
Article Name: E.coli LMP1 protein
Biozol Catalog Number: BYT-ORB246485
Supplier Catalog Number: orb246485
Alternative Catalog Number: BYT-ORB246485-20,BYT-ORB246485-100,BYT-ORB246485-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: LMP1
This E.coli LMP1 protein spans the amino acid sequence from region 185-386aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 37 kDa
UniProt: P13198
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Application Notes: Biological Origin: Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4). Application Notes: Full length of Cytoplasmic of His-SUMO-tag and expression region is 185-386aa
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.