Yeast G protein

Catalog Number: BYT-ORB246838
Article Name: Yeast G protein
Biozol Catalog Number: BYT-ORB246838
Supplier Catalog Number: orb246838
Alternative Catalog Number: BYT-ORB246838-20,BYT-ORB246838-100,BYT-ORB246838-1
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: G
This Yeast G protein spans the amino acid sequence from region 20-459aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 51.4 kDa
UniProt: A3RM22
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Rabies virus (strain PM) (RABV)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD
Application Notes: Biological Origin: Rabies virus (strain PM) (RABV). Application Notes: This is His-tag protein
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rabies virus (strain India) (RABV) G.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Rabies virus (strain India) (RABV) G.