Recombinant Mouse L-amino-acid oxidase (Il4i1)

Catalog Number: BYT-ORB2657880
Article Name: Recombinant Mouse L-amino-acid oxidase (Il4i1)
Biozol Catalog Number: BYT-ORB2657880
Supplier Catalog Number: orb2657880
Alternative Catalog Number: BYT-ORB2657880-1,BYT-ORB2657880-100,BYT-ORB2657880-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: LAAO,Interleukin-4-induced protein 1,Protein Fig-1
This Recombinant Mouse L-amino-acid oxidase (Il4i1) spans the amino acid sequence from region 22-630aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 71.7 kDa
UniProt: O09046
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Mus musculus (Mouse)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: DWKAASSLNPIEKCMEDHDYEQLLKVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEKTGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPEKLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSRPAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSL
Application Notes: Biological Origin: Mus musculus (Mouse). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of Il4i1 was greater than 90% as determined by SEC-HPLC