Recombinant Human Cell adhesion molecule 1 (CADM1), partial

Catalog Number: BYT-ORB2658152
Article Name: Recombinant Human Cell adhesion molecule 1 (CADM1), partial
Biozol Catalog Number: BYT-ORB2658152
Supplier Catalog Number: orb2658152
Alternative Catalog Number: BYT-ORB2658152-1,BYT-ORB2658152-100,BYT-ORB2658152-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Immunoglobulin superfamily member 4 (IgSF4),Nectin-like protein 2 (NECL-2),Spermatogenic immunoglobulin superfamily (SgIgSF),Synaptic cell adhesion molecule (SynCAM),Tumor suppressor in lung cancer 1 (TSLC-1)
This Recombinant Human Cell adhesion molecule 1 (CADM1), partial spans the amino acid sequence from region 45-374aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 66.0 kDa
UniProt: Q9BY67
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLF
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of CADM1 was greater than 90% as determined by SEC-HPLC