Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1) (F484A,T518A,R523A,W731A), partial, Fluorescent-VLPs

Catalog Number: BYT-ORB2658155
Article Name: Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1) (F484A,T518A,R523A,W731A), partial, Fluorescent-VLPs
Biozol Catalog Number: BYT-ORB2658155
Supplier Catalog Number: orb2658155
Alternative Catalog Number: BYT-ORB2658155-1,BYT-ORB2658155-100,BYT-ORB2658155-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: GluN1,Glutamate [NMDA] receptor subunit zeta-1,N-methyl-D-aspartate receptor subunit NR1,NMD-R1
This Recombinant Rat Glutamate receptor ionotropic, NMDA 1 (Grin1)(F484A,T518A,R523A,W731A), partial-VLPs, Fluorescent spans the amino acid sequence from region 396-800aa(F484A,T518A,R523A,W731A). Purity: The purity information is not available for VLPs proteins.
Molecular Weight: 73.0 kDa
UniProt: P35439
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Rattus norvegicus (Rat)
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: TRLKIVTIHQEPFVYVKPTMSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKAGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLAINNEAAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTAN
Application Notes: Biological Origin: Rattus norvegicus (Rat). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-GFP monoclonal antibody.
The purity of VLPs was greater than 95% as determined by SEC-HPLC