Recombinant Methanobacterium formicicum Probable formate transporter (fdhC)-VLPs

Catalog Number: BYT-ORB2658196
Article Name: Recombinant Methanobacterium formicicum Probable formate transporter (fdhC)-VLPs
Biozol Catalog Number: BYT-ORB2658196
Supplier Catalog Number: orb2658196
Alternative Catalog Number: BYT-ORB2658196-1,BYT-ORB2658196-100,BYT-ORB2658196-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Methanobacterium formicicum Probable formate transporter (fdhC)-VLPs spans the amino acid sequence from region 1-280aa. Purity: The purity information is not available for VLPs proteins.
Molecular Weight: 30.8 kDa
UniProt: P35839
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Methanobacterium formicicum
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: MASSFKSPADTAKACVGVAALKEKAPLSNLIVLSFVAGAYIAFGGLLAEVATGGMAAAGWPTGLVKLVFGGVFPVGLMLVVIAGSELFTGNCMYMPMGILQGEASVMGTIKNWVGSWVFNLVGALFVAYVLAYLTGILTAEPWAATAVTIAKTKALGGAQFIAAGKTVTSLSWMQVFWRAIGCNWLVCLAVYLAVASDDVIGKSFGIWFPIMAFVCIGFEHVVANMFFIPVGIFIGGVTWSQFFINNMIPATLGN
Application Notes: Biological Origin: Methanobacterium formicicum. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody.
The purity of VLPs was greater than 90% as determined by SEC-HPLC