Recombinant Bovine Fibroblast growth factor 1 (FGF1)

Catalog Number: BYT-ORB2658328
Article Name: Recombinant Bovine Fibroblast growth factor 1 (FGF1)
Biozol Catalog Number: BYT-ORB2658328
Supplier Catalog Number: orb2658328
Alternative Catalog Number: BYT-ORB2658328-1,BYT-ORB2658328-100,BYT-ORB2658328-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: FGF-1,Acidic eye-derived growth factor II,EDGF II,Acidic fibroblast growth factor,aFGF,Endothelial cell growth factor,ECGF,Heparin-binding growth factor 1,HBGF-1,Prostatropin
This Recombinant Bovine Fibroblast growth factor 1 (FGF1) spans the amino acid sequence from region 2-155aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 18.8 kDa
UniProt: P03968
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Bos taurus (Bovine)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AEGETTTFTALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGTVDGTKDRSDQHIQLQLCAESIGEVYIKSTETGQFLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKHWFVGLKKNGRSKLGPRTHFGQKAILFLPLPVSSD
Application Notes: Biological Origin: Bos taurus (Bovine). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of FGF1 was greater than 95% as determined by SEC-HPLC