Recombinant Chicken Pro-epidermal growth factor (EGF), partial

Catalog Number: BYT-ORB2658330
Article Name: Recombinant Chicken Pro-epidermal growth factor (EGF), partial
Biozol Catalog Number: BYT-ORB2658330
Supplier Catalog Number: orb2658330
Alternative Catalog Number: BYT-ORB2658330-1,BYT-ORB2658330-100,BYT-ORB2658330-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Chicken Pro-epidermal growth factor (EGF), partial spans the amino acid sequence from region 1026-1080aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 8.2 kDa
UniProt: Q6PPB4
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Gallus gallus (Chicken)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: GDSIGCPPAYDSYCLHGGVCNYVSDLQDYACNCVTGYVGERCQFSDLEWWEQQHA
Application Notes: Biological Origin: Gallus gallus (Chicken). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of EGF was greater than 95% as determined by SEC-HPLC