Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)

Catalog Number: BYT-ORB2658857
Article Name: Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active)
Biozol Catalog Number: BYT-ORB2658857
Supplier Catalog Number: orb2658857
Alternative Catalog Number: BYT-ORB2658857-1,BYT-ORB2658857-100,BYT-ORB2658857-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor Gene names
This Recombinant Mouse Tumor necrosis factor ligand superfamily member 15 (Tnfsf15), partial (Active) spans the amino acid sequence from region 61-252aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 24.3 kDa
UniProt: Q5UBV8
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Mus musculus (Mouse)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
Application Notes: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 µg/mL can bind Anti-TNFSF15 recombinant antibody. The EC50 is 1.671-2.506 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse Tnfsf15 at 2 µg/ml can bind Anti-TNFSF15 recombinant antibody. The EC50 is 1.671-2.506 ng/mL.