Recombinant Macaca fascicularis Alkaline phosphatase, placental type (ALPP) (Active)

Catalog Number: BYT-ORB2658858
Article Name: Recombinant Macaca fascicularis Alkaline phosphatase, placental type (ALPP) (Active)
Biozol Catalog Number: BYT-ORB2658858
Supplier Catalog Number: orb2658858
Alternative Catalog Number: BYT-ORB2658858-1,BYT-ORB2658858-100,BYT-ORB2658858-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
This Recombinant Macaca fascicularis Alkaline phosphatase, placental type (ALPP) (Active) spans the amino acid sequence from region 21-504aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 54.1 kDa
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: IIPVEEENPDFWNRQAAEALGAAKKLQPIQTAAKNLIIFLGDGMGVSTVTAARILKGQKEEKLGPETPLAMDHFPYVALSKTYSVDKHVPDSAATATAYLCGVKGNFQTIGLSAAARYNQCNTTRGNEVVSVMNRAKKAGKSVGVVTTTRVQHASPAGAYAHTVNRNWYSDANMPGSARREGCKDIATQLISNMDIDVILGGGRKYMFRMGAPDPEYPHDYSQDGTRMDGKNLVQEWLAKHQGARYVWNRTELMQ
Application Notes: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37C, pH10.0.The specific activity is >7000 U/mg. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of ALPP was greater than 95% as determined by SEC-HPLC