Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)

Catalog Number: BYT-ORB2658859
Article Name: Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active)
Biozol Catalog Number: BYT-ORB2658859
Supplier Catalog Number: orb2658859
Alternative Catalog Number: BYT-ORB2658859-1,BYT-ORB2658859-100,BYT-ORB2658859-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Transmembrane 4 superfamily member 3, Tumor-associated antigen CO-029
This Recombinant Human Tetraspanin-8 (TSPAN8)-VLPs (Active) spans the amino acid sequence from region 1-237aa. Purity: The purity information is not available for VLPs proteins.
Molecular Weight: 27.4 kDa
UniProt: P19075
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Source: Homo sapiens (Human)
Purity: The purity information is not available for VLPs proteins.
Form: Lyophilized powder
Sequence: MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 µg/mL can bind Anti-TSPAN8 recombinant antibody. The EC50 is 2.261-2.623 ng/mL. The VLPs is negative control. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Detected by Mouse anti-6*His monoclonal antibody. (This tag can be tested only under denaturing conditions.)
Measured by its binding ability in a functional ELISA. Immobilized Human TSPAN8 at 5 µg/ml can bind Anti-TSPAN8 recombinant antibody. The EC50 is 2.261-2.623 ng/mL.The VLPs is negative control.