Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)

Catalog Number: BYT-ORB2659839
Article Name: Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active)
Biozol Catalog Number: BYT-ORB2659839
Supplier Catalog Number: orb2659839
Alternative Catalog Number: BYT-ORB2659839-1,BYT-ORB2659839-100,BYT-ORB2659839-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Thymic stromal lymphopoietin, TSLP
This Recombinant Macaca fascicularis Thymic stromal lymphopoietin (TSLP) (R127A,R130S) (Active) spans the amino acid sequence from region 29-159aa(R127A,R130S). Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 16.4 kDa
UniProt: A0A7N9CAT7
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: YDFTNCDFQKIEADYLRTISKDLITYMSGTKSTDFNNTVSCSNRPHCLTEIQSLTFNPTPRCASLAKEMFARKTKATLALWCPGYSETQINATQAMKKARKSKVTTNKCLEQVSQLLGLWRRFIRTLLKKQ
Application Notes: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Loaded Cynomolgus TSLP (R127A, R130S) on 96-Flat plate, can bind anti-TSLP antibody, with an affinity constant of 4.41 nM as determined in BLI assay (Gator Prime)