Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Catalog Number: BYT-ORB2666681
Article Name: Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)
Biozol Catalog Number: BYT-ORB2666681
Supplier Catalog Number: orb2666681
Alternative Catalog Number: BYT-ORB2666681-1,BYT-ORB2666681-100,BYT-ORB2666681-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: IgG Fc receptor III-A,CD16-II,CD16a antigen,Fc-gamma RIII-alpha,Fc-gamma RIII,Fc-gamma RIIIa,FcRIII,FcRIIIa,FcgammaRIIIA,FcR-10,IgG Fc receptor III-2,CD antigen CD16a
This Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial spans the amino acid sequence from region 21-208aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 22.7 kDa
UniProt: P08637
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human FCGR3A at 2 µg/mL can bind Anti-FCGR3A recombinant antibody. The EC50 is 0.2330-0.3147 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of FCGR3A was greater than 90% as determined by SEC-HPLC