Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)

Catalog Number: BYT-ORB2666698
Article Name: Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial (Active)
Biozol Catalog Number: BYT-ORB2666698
Supplier Catalog Number: orb2666698
Alternative Catalog Number: BYT-ORB2666698-1,BYT-ORB2666698-100,BYT-ORB2666698-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Sodium-phosphate transport protein 2B,Na+,NaPi3b,Sodium/phosphate cotransporter 2B,Na+,NaPi-2b,Solute carrier family 34 member 2
This Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2),partial spans the amino acid sequence from region 234-362aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molecular Weight: 45.5 kDa
UniProt: O95436
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 90% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: VEVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDL
Application Notes: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 µg/mL can bind Anti-SLC34A2 recombinant antibody. The EC50 is 32.86-37.66 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human SLC34A2 at 2 µg/ml can bind Anti-SLC34A2 recombinant antibody. The EC50 is 32.86-37.66 ng/mL.