Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)

Catalog Number: BYT-ORB2992168
Article Name: Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)
Biozol Catalog Number: BYT-ORB2992168
Supplier Catalog Number: orb2992168
Alternative Catalog Number: BYT-ORB2992168-1,BYT-ORB2992168-100,BYT-ORB2992168-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: /
This Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active) spans the amino acid sequence from region 19-141aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 15.3 kDa
UniProt: F7A802
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Macaca mulatta (Rhesus macaque)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE
Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 µg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 4.473-4.933 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta CD47 at 2 µg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 4.473-4.933 ng/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.