Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)

Catalog Number: BYT-ORB2992216
Article Name: Recombinant Macaca mulatta Interferon gamma (IFNG) (Active)
Biozol Catalog Number: BYT-ORB2992216
Supplier Catalog Number: orb2992216
Alternative Catalog Number: BYT-ORB2992216-1,BYT-ORB2992216-100,BYT-ORB2992216-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Interferon gamma, IFN-gamma, IFNG
This Recombinant Macaca mulatta Interferon gamma (IFNG) (Active) spans the amino acid sequence from region 24-165aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molecular Weight: 18.1 kDa
UniProt: P63310
Buffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Source: Macaca mulatta (Rhesus macaque)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Lyophilized powder
Sequence: QDPYVKEAENLKKYFNAGDPDVADNGTLFLDILRNWKEESDRKIMQSQIVSFYFKLFKNFKDDQRIQKSVETIKEDINVKFFNSNKKKRDDFEKLTNYSVTDSNVQRKAVHELIQVMAELSPAAKIGKRKRSQMFRGRRASQ
Application Notes: Biological Origin: Macaca mulatta (Rhesus macaque). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta IFNG at 2 µg/mL can bind anti-IFNG recombinant antibody. The EC50 is 35.23-38.98 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
Measured by its binding ability in a functional ELISA. Immobilized Macaca mulatta IFNG at 2 µg/mL can bind anti-IFNG recombinant antibody. The EC50 is 35.23-38.98 ng/mL.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.