Recombinant Human Calcium-binding protein 39(CAB39)

Catalog Number: BYT-ORB2992316
Article Name: Recombinant Human Calcium-binding protein 39(CAB39)
Biozol Catalog Number: BYT-ORB2992316
Supplier Catalog Number: orb2992316
Alternative Catalog Number: BYT-ORB2992316-1,BYT-ORB2992316-100,BYT-ORB2992316-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: MO25alpha,Protein Mo25
This Recombinant Human Calcium-binding protein 39 (CAB39) spans the amino acid sequence from region 1-341. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 67.7 kDa
UniProt: Q9Y376
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Source: Homo sapiens (Human)
Purity: Greater than 95% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRFFSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPEN
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.