ZFP67 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324428
- Images (6)
| Article Name: | ZFP67 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: | BYT-ORB324428 |
| Supplier Catalog Number: | orb324428 |
| Alternative Catalog Number: | BYT-ORB324428-100 |
| Manufacturer: | Biorbyt |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | The immunogen is a synthetic peptide directed towards the middle region of human ZFP67 |
| Conjugation: | Unconjugated |
| Alternative Names: | anti THPOK antibody, anti ZFP67 antibody, anti ZBTB15 antibody, anti ZFP-67 antibody, anti c-KROX antibody, anti hcKROX antibody, anti ZNF857B antibody |
| Rabbit polyclonal antibody to ZBTB7B |
| Clonality: | Polyclonal |
| Concentration: | 1.0 mg/ml |
| Molecular Weight: | 58kDa |
| NCBI: | 056956 |
| UniProt: | O15156 |
| Buffer: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: | Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP |
| Target: | ZBTB7B |
|
|
Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.25 ug/mL, Peptide Concentration: 1.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. |
|
|
Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL. |
|
|
Positive control (+): Human lung (LU), Negative control (-): 293T (2T), Antibody concentration: 1 ug/mL. |
|
|
Human Heart |
|
|
Human Lung |
|
|
WB Suggested Anti-ZFP67 Antibody Titration: 1.0-2.0 ug/mL, Positive Control: HepG2 cell lysate. |
Product Guarantee and Expert Support
