Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG
Target:
MED17
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
Sample Tissue: Human HepG2 Whole Cell, Antibody Dilution: 1 ug/mL.
Human Brain
Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
WB Suggested Anti-CRSP6 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate, MED17 is supported by BioGPS gene expression data to be expressed in HepG2.
* VAT and and shipping costs not included. Errors and price changes excepted