The immunogen is a synthetic peptide directed towards the middle region of human PEO1
Conjugation:
Unconjugated
Alternative Names:
anti C10orf2 antibody, anti FLJ21832 antibody, anti PEO antibody, anti PEOA3 antibody, anti SANDO antibody, anti TWINL antibody, anti PEO1 antibody, anti SCA8 antibody, anti ATXN8 antibody, anti IOSCA antibody, anti MTDPS7 antibody
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: GVFRKFATDNNCHVTLVIHPRKEDDDKELQTASIFGSAKASQEADNVLIL
Target:
TWNK
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. An isoform containing the peptide sequence is present at ~60 kDa.
Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/mL.
Sample Type: Hela, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/mL, Peptide Concentration: 5.0 ug/mL, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. C10orf2 is supported by BioGPS gene expression data to be expressed in Hela.
Positive control (+): HepG2 (HG), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/mL.
